Lineage for d2o25b1 (2o25 B:157-199)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1480920Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 1480944Superfamily a.5.2: UBA-like [46934] (5 families) (S)
  5. 1480945Family a.5.2.1: UBA domain [46935] (25 proteins)
  6. 1481026Protein Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal domain [140327] (1 species)
  7. 1481027Species Human (Homo sapiens) [TaxId:9606] [140328] (6 PDB entries)
    Uniprot P61086 157-198
  8. 1481034Domain d2o25b1: 2o25 B:157-199 [138888]
    Other proteins in same PDB: d2o25a2, d2o25b2, d2o25c_, d2o25d_
    automated match to d1ylaa1

Details for d2o25b1

PDB Entry: 2o25 (more details), 2.6 Å

PDB Description: Ubiquitin-Conjugating Enzyme E2-25 kDa Complexed With SUMO-1-Conjugating Enzyme UBC9
PDB Compounds: (B:) Ubiquitin-conjugating enzyme E2-25 kDa

SCOPe Domain Sequences for d2o25b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o25b1 a.5.2.1 (B:157-199) Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
vsspeytkkienlcamgfdrnavivalsskswdvetatellls

SCOPe Domain Coordinates for d2o25b1:

Click to download the PDB-style file with coordinates for d2o25b1.
(The format of our PDB-style files is described here.)

Timeline for d2o25b1: