SCOPe 2.03: Domain d2o25b1: 2o25 B:157-199

Lineage for d2o25b1 (2o25 B:157-199)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
   3 helices; bundle, right-handed twist

4. Superfamily a.5.2: UBA-like [46934] (4 families)

5. Family a.5.2.1: UBA domain [46935] (25 proteins)

6. Protein Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal domain [140327] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [140328] (6 PDB entries)
   Uniprot P61086 157-198

8. Domain d2o25b1: 2o25 B:157-199 [138888]
   Other proteins in same PDB: d2o25a2, d2o25b2, d2o25c_, d2o25d_
   automated match to d1ylaa1

Details for d2o25b1

PDB Entry: 2o25, 2.6 Å

PDB Description: Ubiquitin-Conjugating Enzyme E2-25 kDa Complexed With SUMO-1-Conjugating Enzyme UBC9

PDB Compounds: (B:) Ubiquitin-conjugating enzyme E2-25 kDa

SCOPe Domain Sequences for d2o25b1:

Sequence; same for both SEQRES and ATOM records:

>d2o25b1 a.5.2.1 (B:157-199) Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
vsspeytkkienlcamgfdrnavivalsskswdvetatellls

Timeline for d2o25b1:

• d2o25b1 first appeared in SCOP 1.73
  
• d2o25b1 appears in SCOPe 2.02
  
• d2o25b1 appears in SCOPe 2.04
  
• d2o25b1 appears in the current release, SCOPe 2.08