Lineage for d2o25b1 (2o25 B:157-198)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 636335Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 636359Superfamily a.5.2: UBA-like [46934] (4 families) (S)
  5. 636360Family a.5.2.1: UBA domain [46935] (22 protein domains)
  6. 636455Protein Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal domain [140327] (1 species)
  7. 636456Species Human (Homo sapiens) [TaxId:9606] [140328] (2 PDB entries)
  8. 636460Domain d2o25b1: 2o25 B:157-198 [138888]
    Other proteins in same PDB: d2o25a2, d2o25b2, d2o25c1, d2o25d1
    automatically matched to 1YLA A:157-198

Details for d2o25b1

PDB Entry: 2o25 (more details), 2.6 Å

PDB Description: Ubiquitin-Conjugating Enzyme E2-25 kDa Complexed With SUMO-1-Conjugating Enzyme UBC9
PDB Compounds: (B:) Ubiquitin-conjugating enzyme E2-25 kDa

SCOP Domain Sequences for d2o25b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o25b1 a.5.2.1 (B:157-198) Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
vsspeytkkienlcamgfdrnavivalsskswdvetatelll

SCOP Domain Coordinates for d2o25b1:

Click to download the PDB-style file with coordinates for d2o25b1.
(The format of our PDB-style files is described here.)

Timeline for d2o25b1: