![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies) 3 helices; bundle, right-handed twist |
![]() | Superfamily a.5.2: UBA-like [46934] (4 families) ![]() |
![]() | Family a.5.2.1: UBA domain [46935] (22 proteins) |
![]() | Protein Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal domain [140327] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [140328] (2 PDB entries) |
![]() | Domain d2o25b1: 2o25 B:157-198 [138888] Other proteins in same PDB: d2o25a2, d2o25b2, d2o25c1, d2o25d1 automatically matched to 1YLA A:157-198 |
PDB Entry: 2o25 (more details), 2.6 Å
SCOP Domain Sequences for d2o25b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o25b1 a.5.2.1 (B:157-198) Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} vsspeytkkienlcamgfdrnavivalsskswdvetatelll
Timeline for d2o25b1:
![]() Domains from other chains: (mouse over for more information) d2o25a1, d2o25a2, d2o25c1, d2o25d1 |