SCOPe 2.06: Domain d2o25a2: 2o25 A:1-156

Lineage for d2o25a2 (2o25 A:1-156)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain [143063] (2 species)
   ubc1 homologue; also contains the C-terminal UBA domain

7. Species Human (Homo sapiens) [TaxId:9606] [143064] (7 PDB entries)
   Uniprot P61086 1-156

8. Domain d2o25a2: 2o25 A:1-156 [138887]
   Other proteins in same PDB: d2o25a1, d2o25b1, d2o25c_, d2o25d_
   automated match to d1ylaa2

Details for d2o25a2

PDB Entry: 2o25, 2.6 Å

PDB Description: Ubiquitin-Conjugating Enzyme E2-25 kDa Complexed With SUMO-1-Conjugating Enzyme UBC9

PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2-25 kDa

SCOPe Domain Sequences for d2o25a2:

Sequence; same for both SEQRES and ATOM records:

>d2o25a2 d.20.1.1 (A:1-156) Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain {Human (Homo sapiens) [TaxId: 9606]}
maniavqrikrefkevlkseetsknqikvdlvdenftelrgeiagppdtpyeggryqlei
kipetypfnppkvrfitkiwhpnissvtgaicldilkdqwaaamtlrtvllslqallaaa
epddpqdavvanqykqnpemfkqtarlwahvyagap

Timeline for d2o25a2:

• d2o25a2 first appeared in SCOP 1.73
  
• d2o25a2 appears in SCOPe 2.05
  
• d2o25a2 appears in SCOPe 2.07
  
• d2o25a2 appears in the current release, SCOPe 2.08