Lineage for d2o25a2 (2o25 A:1-156)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 720005Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 720006Superfamily d.20.1: UBC-like [54495] (4 families) (S)
  5. 720007Family d.20.1.1: UBC-related [54496] (6 proteins)
  6. 720139Protein Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain [143063] (2 species)
    ubc1 homologue; also contains the C-terminal UBA domain
  7. 720143Species Human (Homo sapiens) [TaxId:9606] [143064] (2 PDB entries)
  8. 720146Domain d2o25a2: 2o25 A:1-156 [138887]
    Other proteins in same PDB: d2o25a1, d2o25b1, d2o25c1, d2o25d1
    automatically matched to 1YLA A:1-156

Details for d2o25a2

PDB Entry: 2o25 (more details), 2.6 Å

PDB Description: Ubiquitin-Conjugating Enzyme E2-25 kDa Complexed With SUMO-1-Conjugating Enzyme UBC9
PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2-25 kDa

SCOP Domain Sequences for d2o25a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o25a2 d.20.1.1 (A:1-156) Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain {Human (Homo sapiens) [TaxId: 9606]}
maniavqrikrefkevlkseetsknqikvdlvdenftelrgeiagppdtpyeggryqlei
kipetypfnppkvrfitkiwhpnissvtgaicldilkdqwaaamtlrtvllslqallaaa
epddpqdavvanqykqnpemfkqtarlwahvyagap

SCOP Domain Coordinates for d2o25a2:

Click to download the PDB-style file with coordinates for d2o25a2.
(The format of our PDB-style files is described here.)

Timeline for d2o25a2: