Lineage for d2o22a_ (2o22 A:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2626588Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 2626682Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 2626683Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
    Pfam PF00452
  6. 2626809Protein Bcl-2 [64524] (1 species)
  7. 2626810Species Human (Homo sapiens) [TaxId:9606] [64525] (18 PDB entries)
  8. 2626832Domain d2o22a_: 2o22 A: [138883]
    automated match to d2o22a1
    complexed with liu

Details for d2o22a_

PDB Entry: 2o22 (more details)

PDB Description: Solution structure of the anti-apoptotic protein Bcl-2 in complex with an acyl-sulfonamide-based ligand
PDB Compounds: (A:) Apoptosis regulator Bcl-2

SCOPe Domain Sequences for d2o22a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o22a_ f.1.4.1 (A:) Bcl-2 {Human (Homo sapiens) [TaxId: 9606]}
hagrtgydnreivmkyihyklsqrgyewdagddveenrteapegtesevvhltlrqagdd
fsrryrrdfaemssqlhltpftargrfatvveelfrdgvnwgrivaffefggvmcvesvn
remsplvdnialwmteylnrhlhtwiqdnggwdafvelygpsmr

SCOPe Domain Coordinates for d2o22a_:

Click to download the PDB-style file with coordinates for d2o22a_.
(The format of our PDB-style files is described here.)

Timeline for d2o22a_: