Lineage for d2o22a1 (2o22 A:1-204)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1454901Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 1454943Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 1454944Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
    Pfam PF00452
  6. 1455008Protein Bcl-2 [64524] (1 species)
  7. 1455009Species Human (Homo sapiens) [TaxId:9606] [64525] (9 PDB entries)
  8. 1455017Domain d2o22a1: 2o22 A:1-204 [138883]
    automatically matched to d1gjha_
    complexed with liu

Details for d2o22a1

PDB Entry: 2o22 (more details)

PDB Description: Solution structure of the anti-apoptotic protein Bcl-2 in complex with an acyl-sulfonamide-based ligand
PDB Compounds: (A:) Apoptosis regulator Bcl-2

SCOPe Domain Sequences for d2o22a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o22a1 f.1.4.1 (A:1-204) Bcl-2 {Human (Homo sapiens) [TaxId: 9606]}
hagrtgydnreivmkyihyklsqrgyewdagddveenrteapegtesevvhltlrqagdd
fsrryrrdfaemssqlhltpftargrfatvveelfrdgvnwgrivaffefggvmcvesvn
remsplvdnialwmteylnrhlhtwiqdnggwdafvelygpsmr

SCOPe Domain Coordinates for d2o22a1:

Click to download the PDB-style file with coordinates for d2o22a1.
(The format of our PDB-style files is described here.)

Timeline for d2o22a1: