SCOP 1.73: Domain d2o22a1: 2o22 A:1-204

Lineage for d2o22a1 (2o22 A:1-204)

1. Root: SCOP 1.73

2. Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (1 family)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (10 proteins)
   Pfam PF00452

6. Protein Bcl-2 [64524] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64525] (5 PDB entries)

8. Domain d2o22a1: 2o22 A:1-204 [138883]
   automatically matched to d1gjha_
   complexed with liu

Details for d2o22a1

PDB Entry: 2o22

PDB Description: Solution structure of the anti-apoptotic protein Bcl-2 in complex with an acyl-sulfonamide-based ligand

PDB Compounds: (A:) Apoptosis regulator Bcl-2

SCOP Domain Sequences for d2o22a1:

Sequence; same for both SEQRES and ATOM records:

>d2o22a1 f.1.4.1 (A:1-204) Bcl-2 {Human (Homo sapiens) [TaxId: 9606]}
hagrtgydnreivmkyihyklsqrgyewdagddveenrteapegtesevvhltlrqagdd
fsrryrrdfaemssqlhltpftargrfatvveelfrdgvnwgrivaffefggvmcvesvn
remsplvdnialwmteylnrhlhtwiqdnggwdafvelygpsmr

Timeline for d2o22a1:

• d2o22a1 is new in SCOP 1.73
  
• d2o22a1 appears in SCOP 1.75
  
• d2o22a1 appears in the current release, SCOPe 2.08, called d2o22a_