Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies) multi-helical domains of various folds which is thought to unfold in the membrane |
Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain |
Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins) Pfam PF00452 |
Protein Bcl-2 [64524] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [64525] (18 PDB entries) |
Domain d2o21a_: 2o21 A: [138882] automated match to d1gjha_ complexed with 43b |
PDB Entry: 2o21 (more details)
SCOPe Domain Sequences for d2o21a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o21a_ f.1.4.1 (A:) Bcl-2 {Human (Homo sapiens) [TaxId: 9606]} hagrtgydnreivmkyihyklsqrgyewdagddveenrteapegtesevvhltlrqagdd fsrryrrdfaemssqlhltpftargrfatvveelfrdgvnwgrivaffefggvmcvesvn remsplvdnialwmteylnrhlhtwiqdnggwdafvelygpsmr
Timeline for d2o21a_: