SCOPe 2.07: Domain d2o21a_: 2o21 A:

Lineage for d2o21a_ (2o21 A:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein Bcl-2 [64524] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64525] (18 PDB entries)

8. Domain d2o21a_: 2o21 A: [138882]
   automated match to d1gjha_
   complexed with 43b

Details for d2o21a_

PDB Entry: 2o21

PDB Description: solution structure of the anti-apoptotic protein bcl-2 in complex with an acyl-sulfonamide-based ligand

PDB Compounds: (A:) Apoptosis regulator Bcl-2

SCOPe Domain Sequences for d2o21a_:

Sequence; same for both SEQRES and ATOM records:

>d2o21a_ f.1.4.1 (A:) Bcl-2 {Human (Homo sapiens) [TaxId: 9606]}
hagrtgydnreivmkyihyklsqrgyewdagddveenrteapegtesevvhltlrqagdd
fsrryrrdfaemssqlhltpftargrfatvveelfrdgvnwgrivaffefggvmcvesvn
remsplvdnialwmteylnrhlhtwiqdnggwdafvelygpsmr

Timeline for d2o21a_:

• d2o21a_ first appeared in SCOP 1.73, called d2o21a1
  
• d2o21a_ appears in SCOPe 2.06
  
• d2o21a_ appears in the current release, SCOPe 2.08