Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies) multi-helical domains of various folds which is thought to unfold in the membrane |
Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain |
Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins) Pfam PF00452 |
Protein Apoptosis regulator Bcl-xL [56856] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [56857] (31 PDB entries) |
Domain d2o1ya_: 2o1y A: [138881] automated match to d1g5ja_ complexed with 43b |
PDB Entry: 2o1y (more details)
SCOPe Domain Sequences for d2o1ya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o1ya_ f.1.4.1 (A:) Apoptosis regulator Bcl-xL {Human (Homo sapiens) [TaxId: 9606]} msmamsqsnrelvvdflsyklsqkgyswsqfsdveenrteapegteseavkqalreagde felryrrafsdltsqlhitpgtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvd kemqvlvsriaawmatylndhlepwiqenggwdtfvelygnnaaaesrkgqerlehhhhh h
Timeline for d2o1ya_: