![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies) multi-helical domains of various folds which is thought to unfold in the membrane |
![]() | Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) ![]() PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain |
![]() | Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins) Pfam PF00452 |
![]() | Protein Apoptosis regulator Bcl-xL [56856] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [56857] (24 PDB entries) |
![]() | Domain d2o1ya1: 2o1y A:1-213 [138881] automatically matched to d1bxla_ complexed with 43b |
PDB Entry: 2o1y (more details)
SCOPe Domain Sequences for d2o1ya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o1ya1 f.1.4.1 (A:1-213) Apoptosis regulator Bcl-xL {Human (Homo sapiens) [TaxId: 9606]} msmamsqsnrelvvdflsyklsqkgyswsqfsdveenrteapegteseavkqalreagde felryrrafsdltsqlhitpgtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvd kemqvlvsriaawmatylndhlepwiqenggwdtfvelygnnaaaesrkgqer
Timeline for d2o1ya1: