SCOP 1.73: Domain d2o1ya1: 2o1y A:1-213

Lineage for d2o1ya1 (2o1y A:1-213)

1. Root: SCOP 1.73

2. Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (1 family)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (10 proteins)
   Pfam PF00452

6. Protein Apoptosis regulator Bcl-xL [56856] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56857] (14 PDB entries)

8. Domain d2o1ya1: 2o1y A:1-213 [138881]
   automatically matched to d1bxla_
   complexed with 43b

Details for d2o1ya1

PDB Entry: 2o1y

PDB Description: solution structure of the anti-apoptotic protein bcl-xl in complex with an acyl-sulfonamide-based ligand

PDB Compounds: (A:) apoptosis regulator bcl-x

SCOP Domain Sequences for d2o1ya1:

Sequence; same for both SEQRES and ATOM records:

>d2o1ya1 f.1.4.1 (A:1-213) Apoptosis regulator Bcl-xL {Human (Homo sapiens) [TaxId: 9606]}
msmamsqsnrelvvdflsyklsqkgyswsqfsdveenrteapegteseavkqalreagde
felryrrafsdltsqlhitpgtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvd
kemqvlvsriaawmatylndhlepwiqenggwdtfvelygnnaaaesrkgqer

Timeline for d2o1ya1:

• d2o1ya1 is new in SCOP 1.73
  
• d2o1ya1 appears in SCOP 1.75
  
• d2o1ya1 appears in the current release, SCOPe 2.08, called d2o1ya2