Lineage for d2o1pb3 (2o1p B:352-529)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 863067Superfamily d.58.16: PAP/Archaeal CCA-adding enzyme, C-terminal domain [55003] (2 families) (S)
  5. 863068Family d.58.16.1: Poly(A) polymerase, PAP, C-terminal domain [55004] (1 protein)
  6. 863069Protein Poly(A) polymerase, PAP, C-terminal domain [55005] (2 species)
  7. 863070Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55006] (5 PDB entries)
  8. 863076Domain d2o1pb3: 2o1p B:352-529 [138880]
    Other proteins in same PDB: d2o1pa1, d2o1pa2, d2o1pb1, d2o1pb2
    automatically matched to d1fa0b1

Details for d2o1pb3

PDB Entry: 2o1p (more details), 2.7 Å

PDB Description: Structure of yeast Poly(A) Polymerase in a somewhat closed state
PDB Compounds: (B:) poly(a) polymerase

SCOP Domain Sequences for d2o1pb3:

Sequence, based on SEQRES records: (download)

>d2o1pb3 d.58.16.1 (B:352-529) Poly(A) polymerase, PAP, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ndfffrykfyleitaytrgsdeqhlkwsglveskvrllvmklevlagikiahpftkpfes
syccpteddyemiqdkygshktetalnalklvtdenkeeesikdapkaylstmyigldfn
ienkkekvdihipctefvnlcrsfnedygdhkvfnlalrfvkgydlpdevfdenekrp

Sequence, based on observed residues (ATOM records): (download)

>d2o1pb3 d.58.16.1 (B:352-529) Poly(A) polymerase, PAP, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ndfffrykfyleitaytrgsdeqhlkwsglveskvrllvmklevlagikiahpftkpfes
syccpteddyemiqdkygshktetalnalklvtdenkedapkaylstmyigldfnienkk
ekvdihipctefvnlcrsfnedygdhkvfnlalrfvkgydlpdevfdenekrp

SCOP Domain Coordinates for d2o1pb3:

Click to download the PDB-style file with coordinates for d2o1pb3.
(The format of our PDB-style files is described here.)

Timeline for d2o1pb3: