Lineage for d2o1pb2 (2o1p B:4-201)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 740075Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 740076Superfamily d.218.1: Nucleotidyltransferase [81301] (11 families) (S)
  5. 740245Family d.218.1.3: Poly(A) polymerase, PAP, N-terminal domain [81589] (1 protein)
    insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543
  6. 740246Protein Poly(A) polymerase, PAP, N-terminal domain [81588] (2 species)
  7. 740247Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81586] (3 PDB entries)
  8. 740250Domain d2o1pb2: 2o1p B:4-201 [138879]
    Other proteins in same PDB: d2o1pa1, d2o1pa3, d2o1pb1, d2o1pb3
    automatically matched to d1fa0b4

Details for d2o1pb2

PDB Entry: 2o1p (more details), 2.7 Å

PDB Description: Structure of yeast Poly(A) Polymerase in a somewhat closed state
PDB Compounds: (B:) poly(a) polymerase

SCOP Domain Sequences for d2o1pb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o1pb2 d.218.1.3 (B:4-201) Poly(A) polymerase, PAP, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qkvfgitgpvstvgataaenklndsliqelkkegsfeteqetanrvqvlkilqelaqrfv
yevskkknmsdgmardaggkiftygsyrlgvhgpgsdidtlvvvpkhvtredfftvfdsl
lrerkeldeiapvpdafvpiikikfsgisidlicarldqpqvplsltlsdknllrnldek
dlralngtrvtdeilelv

SCOP Domain Coordinates for d2o1pb2:

Click to download the PDB-style file with coordinates for d2o1pb2.
(The format of our PDB-style files is described here.)

Timeline for d2o1pb2: