Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.16: PAP/Archaeal CCA-adding enzyme, C-terminal domain [55003] (3 families) |
Family d.58.16.1: Poly(A) polymerase, PAP, C-terminal domain [55004] (1 protein) automatically mapped to Pfam PF04926 |
Protein Poly(A) polymerase, PAP, C-terminal domain [55005] (2 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55006] (5 PDB entries) |
Domain d2o1pa3: 2o1p A:352-526 [138877] Other proteins in same PDB: d2o1pa1, d2o1pa2, d2o1pa4, d2o1pb1, d2o1pb2, d2o1pb4 automated match to d1fa0a1 |
PDB Entry: 2o1p (more details), 2.7 Å
SCOPe Domain Sequences for d2o1pa3:
Sequence, based on SEQRES records: (download)
>d2o1pa3 d.58.16.1 (A:352-526) Poly(A) polymerase, PAP, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ndfffrykfyleitaytrgsdeqhlkwsglveskvrllvmklevlagikiahpftkpfes syccpteddyemiqdkygshktetalnalklvtdenkeeesikdapkaylstmyigldfn ienkkekvdihipctefvnlcrsfnedygdhkvfnlalrfvkgydlpdevfdene
>d2o1pa3 d.58.16.1 (A:352-526) Poly(A) polymerase, PAP, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ndfffrykfyleitaytrgsdeqhlkwsglveskvrllvmklevlagikiahpftkpfes syccpteddyemiqdkygshktetalnalklvtdeikdapkaylstmyigldfnienkke kvdihipctefvnlcrsfnedygdhkvfnlalrfvkgydlpdevfdene
Timeline for d2o1pa3:
View in 3D Domains from other chains: (mouse over for more information) d2o1pb1, d2o1pb2, d2o1pb3, d2o1pb4 |