| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.218: Nucleotidyltransferase [81302] (1 superfamily) core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123 |
Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) ![]() |
| Family d.218.1.3: Poly(A) polymerase, PAP, N-terminal domain [81589] (1 protein) insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543 |
| Protein Poly(A) polymerase, PAP, N-terminal domain [81588] (2 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81586] (5 PDB entries) |
| Domain d2o1pa2: 2o1p A:4-201 [138876] Other proteins in same PDB: d2o1pa1, d2o1pa3, d2o1pa4, d2o1pb1, d2o1pb3, d2o1pb4 automated match to d3c66a2 |
PDB Entry: 2o1p (more details), 2.7 Å
SCOPe Domain Sequences for d2o1pa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o1pa2 d.218.1.3 (A:4-201) Poly(A) polymerase, PAP, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qkvfgitgpvstvgataaenklndsliqelkkegsfeteqetanrvqvlkilqelaqrfv
yevskkknmsdgmardaggkiftygsyrlgvhgpgsdidtlvvvpkhvtredfftvfdsl
lrerkeldeiapvpdafvpiikikfsgisidlicarldqpqvplsltlsdknllrnldek
dlralngtrvtdeilelv
Timeline for d2o1pa2:
View in 3DDomains from other chains: (mouse over for more information) d2o1pb1, d2o1pb2, d2o1pb3, d2o1pb4 |