SCOPe 2.06: Domain d2o1na_: 2o1n A:

Lineage for d2o1na_ (2o1n A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
   automatically mapped to Pfam PF00068

6. Protein automated matches [190139] (26 species)
   not a true protein

7. Species Daboia russellii [TaxId:97228] [186865] (27 PDB entries)

8. Domain d2o1na_: 2o1n A: [138874]
   automated match to d1tgma_

Details for d2o1na_

PDB Entry: 2o1n, 2.8 Å

PDB Description: crystal structure of a complex of phospholipase a2 with a peptide ala- ile-ala-ser at 2.8 a resolution

PDB Compounds: (A:) Phospholipase A2 VRV-PL-VIIIa

SCOPe Domain Sequences for d2o1na_:

Sequence; same for both SEQRES and ATOM records:

>d2o1na_ a.133.1.2 (A:) automated matches {Daboia russellii [TaxId: 97228]}
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c

Timeline for d2o1na_:

• d2o1na_ first appeared in SCOP 1.73, called d2o1na1
  
• d2o1na_ appears in SCOPe 2.05
  
• d2o1na_ appears in SCOPe 2.07
  
• d2o1na_ appears in the current release, SCOPe 2.08