Lineage for d2o0ua_ (2o0u A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2586062Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2586063Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2586210Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2586392Protein c-jun N-terminal kinase (jnk3s) [56137] (1 species)
    CMGC group; ERK/MAPK subfamily; serine/threonine kinase
  7. 2586393Species Human (Homo sapiens) [TaxId:9606] [56138] (42 PDB entries)
  8. 2586416Domain d2o0ua_: 2o0u A: [138868]
    automated match to d1jnk__
    complexed with c0m

Details for d2o0ua_

PDB Entry: 2o0u (more details), 2.1 Å

PDB Description: crystal structure of human jnk3 complexed with n-{3-cyano-6-[3-(1- piperidinyl)propanoyl]-4,5,6,7-tetrahydrothieno[2,3-c]pyridin-2-yl}- 1-naphthalenecarboxamide
PDB Compounds: (A:) Mitogen-activated protein kinase 10

SCOPe Domain Sequences for d2o0ua_:

Sequence, based on SEQRES records: (download)

>d2o0ua_ d.144.1.7 (A:) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]}
nqfysvevgdstftvlkryqnlkpigsgaqgivcaaydavldrnvaikklsrpfqnqtha
krayrelvlmkcvnhkniisllnvftpqktleefqdvylvmelmdanlcqviqmeldher
msyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglartagtsfmmtpyvv
tryyrapevilgmgykenvdiwsvgcimgemvrhkilfpgrdyidqwnkvieqlgtpcpe
fmkklqptvrnyvenrpkyagltfpklfpdslfpadsehnklkasqardllskmlvidpa
krisvddalqhpyinvwydpaeveapppqiydkqlderehtieewkeliykevmn

Sequence, based on observed residues (ATOM records): (download)

>d2o0ua_ d.144.1.7 (A:) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]}
nqfysvevgdstftvlkryqnlkpigsgaqgivcaaydavldrnvaikklsrpfqnqtha
krayrelvlmkcvnhkniisllnvftpqktleefqdvylvmelmdanlcqviqmeldher
msyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglarfmmtpyvvtryyr
apevilgmgykenvdiwsvgcimgemvrhkilfpgrdyidqwnkvieqlgtpcpefmkkl
qptvrnyvenrpkyagltfpklfpdslfpadsehnklkasqardllskmlvidpakrisv
ddalqhpyinvwyrehtieewkeliykevmn

SCOPe Domain Coordinates for d2o0ua_:

Click to download the PDB-style file with coordinates for d2o0ua_.
(The format of our PDB-style files is described here.)

Timeline for d2o0ua_: