SCOPe 2.08: Domain d2o0qa1: 2o0q A:2-114

Lineage for d2o0qa1 (2o0q A:2-114)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (8 families)

5. Family d.166.1.7: CC0527-like [143950] (1 protein)
   Pfam PF06108; DUF952

6. Protein Hypothetical protein CC0527 [143951] (1 species)

7. Species Caulobacter crescentus [TaxId:155892] [143952] (3 PDB entries)
   Uniprot Q9AAR9 2-114

8. Domain d2o0qa1: 2o0q A:2-114 [138867]
   Other proteins in same PDB: d2o0qa2

Details for d2o0qa1

PDB Entry: 2o0q, 1.8 Å

PDB Description: X-ray Crystal Structure of Protein CC0527 from Caulobacter crescentus. Northeast Structural Genomics Consortium Target CcR55

PDB Compounds: (A:) Hypothetical protein CC0527

SCOPe Domain Sequences for d2o0qa1:

Sequence; same for both SEQRES and ATOM records:

>d2o0qa1 d.166.1.7 (A:2-114) Hypothetical protein CC0527 {Caulobacter crescentus [TaxId: 155892]}
tliykilsraewdaakaqgrfegsavdladgfihlsageqaqetaakwfrgqanlvllav
eaeplgedlkweasrggarfphlyrpllvsevtreadldldadgvpqlgdhla

Timeline for d2o0qa1:

• d2o0qa1 first appeared in SCOP 1.73
  
• d2o0qa1 appears in SCOPe 2.07