Lineage for d2o07b_ (2o07 B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2500487Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2500488Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2501090Family c.66.1.17: Spermidine synthase [69557] (3 proteins)
    contains additional N-terminal tetramerisation all-beta domain, res. 1-71
  6. 2501095Protein Spermidine synthase [69558] (6 species)
    polyamine aminopropyltransferase
  7. 2501101Species Human (Homo sapiens) [TaxId:9606] [142590] (5 PDB entries)
    Uniprot P19623 15-300
  8. 2501103Domain d2o07b_: 2o07 B: [138863]
    automated match to d2o05a1
    complexed with mta, spd

Details for d2o07b_

PDB Entry: 2o07 (more details), 1.89 Å

PDB Description: Human spermidine synthase
PDB Compounds: (B:) spermidine synthase

SCOPe Domain Sequences for d2o07b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o07b_ c.66.1.17 (B:) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]}
airegwfretcslwpgqalslqveqllhhrrsryqdilvfrsktygnvlvldgviqcter
defsyqemianlplcshpnprkvliigggdggvlrevvkhpsvesvvqceidedviqvsk
kflpgmaigyssskltlhvgdgfefmkqnqdafdviitdssdpmgpaeslfkesyyqlmk
talkedgvlccqgecqwlhldlikemrqfcqslfpvvayayctiptypsgqigfmlcskn
pstnfqepvqpltqqqvaqmqlkyynsdvhraafvlpefarkaln

SCOPe Domain Coordinates for d2o07b_:

Click to download the PDB-style file with coordinates for d2o07b_.
(The format of our PDB-style files is described here.)

Timeline for d2o07b_: