![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (52 families) ![]() |
![]() | Family c.66.1.17: Spermidine synthase [69557] (2 proteins) contains additional N-terminal tetramerisation all-beta domain, res. 1-71 |
![]() | Protein Spermidine synthase [69558] (6 species) polyamine aminopropyltransferase |
![]() | Species Human (Homo sapiens) [TaxId:9606] [142590] (4 PDB entries) |
![]() | Domain d2o05a1: 2o05 A:15-300 [138858] complexed with mta |
PDB Entry: 2o05 (more details), 2 Å
SCOP Domain Sequences for d2o05a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o05a1 c.66.1.17 (A:15-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} airegwfretcslwpgqalslqveqllhhrrsryqdilvfrsktygnvlvldgviqcter defsyqemianlplcshpnprkvliigggdggvlrevvkhpsvesvvqceidedviqvsk kflpgmaigyssskltlhvgdgfefmkqnqdafdviitdssdpmgpaeslfkesyyqlmk talkedgvlccqgecqwlhldlikemrqfcqslfpvvayayctiptypsgqigfmlcskn pstnfqepvqpltqqqvaqmqlkyynsdvhraafvlpefarkalnd
Timeline for d2o05a1: