Lineage for d2nzvl1 (2nzv L:2-88)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 730020Fold d.94: HPr-like [55593] (2 superfamilies)
    beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423
  4. 730021Superfamily d.94.1: HPr-like [55594] (1 family) (S)
  5. 730022Family d.94.1.1: HPr-like [55595] (2 proteins)
  6. 730034Protein Histidine-containing phosphocarrier protein (HPr) [55596] (7 species)
  7. 730035Species Bacillus megaterium [TaxId:1404] [118054] (4 PDB entries)
  8. 730041Domain d2nzvl1: 2nzv L:2-88 [138857]
    Other proteins in same PDB: d2nzvg1
    automatically matched to d1rzrl_
    complexed with fbp, so4

Details for d2nzvl1

PDB Entry: 2nzv (more details), 3 Å

PDB Description: structural mechanism for the fine-tuning of ccpa function by the small molecule effectors g6p and fbp
PDB Compounds: (L:) Phosphocarrier protein HPr

SCOP Domain Sequences for d2nzvl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nzvl1 d.94.1.1 (L:2-88) Histidine-containing phosphocarrier protein (HPr) {Bacillus megaterium [TaxId: 1404]}
aqktftvtadsgiharpattlvqaaskfdsdinlefngktvnlksimgvmslgiqkgati
tisaegsdeadalaaledtmskeglge

SCOP Domain Coordinates for d2nzvl1:

Click to download the PDB-style file with coordinates for d2nzvl1.
(The format of our PDB-style files is described here.)

Timeline for d2nzvl1: