SCOP 1.73: Domain d2nzvl1: 2nzv L:2-88

Lineage for d2nzvl1 (2nzv L:2-88)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.94: HPr-like [55593] (2 superfamilies)
   beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423

4. Superfamily d.94.1: HPr-like [55594] (1 family)

5. Family d.94.1.1: HPr-like [55595] (2 proteins)

6. Protein Histidine-containing phosphocarrier protein (HPr) [55596] (7 species)

7. Species Bacillus megaterium [TaxId:1404] [118054] (4 PDB entries)

8. Domain d2nzvl1: 2nzv L:2-88 [138857]
   Other proteins in same PDB: d2nzvg1
   automatically matched to d1rzrl_
   complexed with fbp, so4

Details for d2nzvl1

PDB Entry: 2nzv, 3 Å

PDB Description: structural mechanism for the fine-tuning of ccpa function by the small molecule effectors g6p and fbp

PDB Compounds: (L:) Phosphocarrier protein HPr

SCOP Domain Sequences for d2nzvl1:

Sequence; same for both SEQRES and ATOM records:

>d2nzvl1 d.94.1.1 (L:2-88) Histidine-containing phosphocarrier protein (HPr) {Bacillus megaterium [TaxId: 1404]}
aqktftvtadsgiharpattlvqaaskfdsdinlefngktvnlksimgvmslgiqkgati
tisaegsdeadalaaledtmskeglge

Timeline for d2nzvl1:

• d2nzvl1 is new in SCOP 1.73
  
• d2nzvl1 appears in SCOP 1.75
  
• d2nzvl1 appears in the current release, SCOPe 2.08, called d2nzvl_