Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) Similar in architecture to the superfamily II but partly differs in topology |
Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins) |
Protein Glucose-resistance amylase regulator CcpA, C-terminal domain [117740] (2 species) |
Species Bacillus megaterium [TaxId:1404] [117741] (10 PDB entries) Uniprot P46828 58-322 ! Uniprot P46828 |
Domain d2nzvg_: 2nzv G: [138856] Other proteins in same PDB: d2nzvl_ automated match to d2nzug_ complexed with fbp, so4 |
PDB Entry: 2nzv (more details), 3 Å
SCOPe Domain Sequences for d2nzvg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nzvg_ c.93.1.1 (G:) Glucose-resistance amylase regulator CcpA, C-terminal domain {Bacillus megaterium [TaxId: 1404]} kktttvgviipdisnifyaelargiediatmykyniilsnsdqnqdkelhllnnmlgkqv dgiifmsgnvteehveelkkspvpvvlaasiestnqipsvtidyeqaafdavqslidsgh kniafvsgtleepinhakkvkgykraltesglpvrdsyivegdytydsgieaveklleed ekptaifvgtdemalgvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvqpmydi gavamrlltkymnketvdssivqlphriefrqstk
Timeline for d2nzvg_: