Lineage for d2nzdb_ (2nzd B:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1082620Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1082621Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 1082622Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1082927Protein Histone H4 [47125] (7 species)
  7. 1082928Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (45 PDB entries)
  8. 1082974Domain d2nzdb_: 2nzd B: [138849]
    Other proteins in same PDB: d2nzda_, d2nzdc_, d2nzdd_, d2nzde_, d2nzdg_, d2nzdh_
    automated match to d1kx5b_
    protein/DNA complex; complexed with mn

Details for d2nzdb_

PDB Entry: 2nzd (more details), 2.65 Å

PDB Description: Nucleosome core particle containing 145 bp of DNA
PDB Compounds: (B:) histone h4

SCOPe Domain Sequences for d2nzdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nzdb_ a.22.1.1 (B:) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
vlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrkt
vtamdvvyalkrqgrtlygfgg

SCOPe Domain Coordinates for d2nzdb_:

Click to download the PDB-style file with coordinates for d2nzdb_.
(The format of our PDB-style files is described here.)

Timeline for d2nzdb_: