Class a: All alpha proteins [46456] (284 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (4 families) |
Family a.22.1.1: Nucleosome core histones [47114] (5 proteins) form octamers composed of two copies of each of the four histones |
Protein Histone H4 [47125] (5 species) |
Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (33 PDB entries) |
Domain d2nzdb1: 2nzd B:24-102 [138849] Other proteins in same PDB: d2nzda1, d2nzdc1, d2nzde1, d2nzdg1 automatically matched to d1p3ob_ complexed with mn |
PDB Entry: 2nzd (more details), 2.65 Å
SCOP Domain Sequences for d2nzdb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nzdb1 a.22.1.1 (B:24-102) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]} dniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvta mdvvyalkrqgrtlygfgg
Timeline for d2nzdb1: