Lineage for d2nzda_ (2nzd A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311419Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2311420Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2311421Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2311654Protein Histone H3 [47122] (6 species)
  7. 2311655Species African clawed frog (Xenopus laevis) [TaxId:8355] [47124] (39 PDB entries)
  8. 2311686Domain d2nzda_: 2nzd A: [138848]
    Other proteins in same PDB: d2nzdb_, d2nzdc_, d2nzdd_, d2nzdf_, d2nzdg_, d2nzdh_
    automated match to d1kx5a_
    protein/DNA complex; complexed with mn

Details for d2nzda_

PDB Entry: 2nzd (more details), 2.65 Å

PDB Description: Nucleosome core particle containing 145 bp of DNA
PDB Compounds: (A:) histone h3

SCOPe Domain Sequences for d2nzda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nzda_ a.22.1.1 (A:) Histone H3 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqease
aylvalfedtnlcaihakrvtimpkdiqlarrirger

SCOPe Domain Coordinates for d2nzda_:

Click to download the PDB-style file with coordinates for d2nzda_.
(The format of our PDB-style files is described here.)

Timeline for d2nzda_: