SCOP 1.75: Domain d2nzda1: 2nzd A:39-134

Lineage for d2nzda1 (2nzd A:39-134)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (4 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (5 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H3 [47122] (5 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [47124] (27 PDB entries)

8. Domain d2nzda1: 2nzd A:39-134 [138848]
   Other proteins in same PDB: d2nzdb1, d2nzdc1, d2nzdf1, d2nzdg1
   automatically matched to d1p3ie_
   complexed with mn

Details for d2nzda1

PDB Entry: 2nzd, 2.65 Å

PDB Description: Nucleosome core particle containing 145 bp of DNA

PDB Compounds: (A:) histone h3

SCOP Domain Sequences for d2nzda1:

Sequence; same for both SEQRES and ATOM records:

>d2nzda1 a.22.1.1 (A:39-134) Histone H3 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
hryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeasea
ylvalfedtnlcaihakrvtimpkdiqlarrirger

Timeline for d2nzda1:

• d2nzda1 first appeared in SCOP 1.73
  
• d2nzda1 is called d2nzda_ in SCOPe 2.01
  
• d2nzda1 appears in the current release, SCOPe 2.08, called d2nzda_