Lineage for d2nz9e2 (2nz9 E:115-215)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2360179Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)
  7. 2360180Species Human (Homo sapiens) [TaxId:9606] [88569] (151 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody
  8. 2360410Domain d2nz9e2: 2nz9 E:115-215 [138845]
    Other proteins in same PDB: d2nz9c1, d2nz9d1, d2nz9d2, d2nz9d3, d2nz9e1, d2nz9f1, d2nz9f2, d2nz9f3
    automatically matched to d1egjl2
    complexed with ca, zn

Details for d2nz9e2

PDB Entry: 2nz9 (more details), 3.79 Å

PDB Description: crystal structure of botulinum neurotoxin type a complexed with monoclonal antibody ar2
PDB Compounds: (E:) AR2 monoclonal antibody

SCOPe Domain Sequences for d2nz9e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nz9e2 b.1.1.2 (E:115-215) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
aapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskd
styslsstltlskadyekhkvyacevthqglsspvtksfnr

SCOPe Domain Coordinates for d2nz9e2:

Click to download the PDB-style file with coordinates for d2nz9e2.
(The format of our PDB-style files is described here.)

Timeline for d2nz9e2: