Lineage for d2nz9c2 (2nz9 C:115-215)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655938Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 656129Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries)
  8. 656498Domain d2nz9c2: 2nz9 C:115-215 [138841]
    Other proteins in same PDB: d2nz9c1, d2nz9d1, d2nz9d2, d2nz9e1, d2nz9f1, d2nz9f2
    automatically matched to d1egjl2
    complexed with ca, zn

Details for d2nz9c2

PDB Entry: 2nz9 (more details), 3.79 Å

PDB Description: crystal structure of botulinum neurotoxin type a complexed with monoclonal antibody ar2
PDB Compounds: (C:) AR2 monoclonal antibody

SCOP Domain Sequences for d2nz9c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nz9c2 b.1.1.2 (C:115-215) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
aapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskd
styslsstltlskadyekhkvyacevthqglsspvtksfnr

SCOP Domain Coordinates for d2nz9c2:

Click to download the PDB-style file with coordinates for d2nz9c2.
(The format of our PDB-style files is described here.)

Timeline for d2nz9c2: