Lineage for d2nz8b2 (2nz8 B:1415-1535)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2412582Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2412583Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2412584Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
    Pfam PF00169
  6. 2412843Protein Triple functional domain protein TRIO [110264] (1 species)
  7. 2412844Species Human (Homo sapiens) [TaxId:9606] [110265] (3 PDB entries)
    Uniprot O75962 1231-1535
  8. 2412846Domain d2nz8b2: 2nz8 B:1415-1535 [138839]
    Other proteins in same PDB: d2nz8a_, d2nz8b1

Details for d2nz8b2

PDB Entry: 2nz8 (more details), 2 Å

PDB Description: n-terminal dhph cassette of trio in complex with nucleotide-free rac1
PDB Compounds: (B:) triple functional domain protein

SCOPe Domain Sequences for d2nz8b2:

Sequence, based on SEQRES records: (download)

>d2nz8b2 b.55.1.1 (B:1415-1535) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]}
egfdeniesqgelilqesfqvwdpktlirkgrerhlflfemslvfskevkdssgrskyly
ksklftselgvtehvegdpckfalwvgrtptsdnkivlkassienkqdwikhireviqer
t

Sequence, based on observed residues (ATOM records): (download)

>d2nz8b2 b.55.1.1 (B:1415-1535) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]}
egfsqgelilqesfqhlflfemslvfskevkdssgrskylyksklftselgvtehvegdp
ckfatsdnkivlkassienkqdwikhireviqert

SCOPe Domain Coordinates for d2nz8b2:

Click to download the PDB-style file with coordinates for d2nz8b2.
(The format of our PDB-style files is described here.)

Timeline for d2nz8b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2nz8b1
View in 3D
Domains from other chains:
(mouse over for more information)
d2nz8a_