SCOP 1.73: Domain d2nz8b2: 2nz8 B:1415-1535

Lineage for d2nz8b2 (2nz8 B:1415-1535)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (12 families)

5. Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (43 proteins)
   Pfam PF00169

6. Protein Triple functional domain protein TRIO [110264] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [110265] (2 PDB entries)

8. Domain d2nz8b2: 2nz8 B:1415-1535 [138839]
   Other proteins in same PDB: d2nz8a1, d2nz8b1
   automatically matched to d1ntya2

Details for d2nz8b2

PDB Entry: 2nz8, 2 Å

PDB Description: n-terminal dhph cassette of trio in complex with nucleotide-free rac1

PDB Compounds: (B:) triple functional domain protein

SCOP Domain Sequences for d2nz8b2:

Sequence, based on SEQRES records:

>d2nz8b2 b.55.1.1 (B:1415-1535) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]}
egfdeniesqgelilqesfqvwdpktlirkgrerhlflfemslvfskevkdssgrskyly
ksklftselgvtehvegdpckfalwvgrtptsdnkivlkassienkqdwikhireviqer
t

Sequence, based on observed residues (ATOM records):

>d2nz8b2 b.55.1.1 (B:1415-1535) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]}
egfsqgelilqesfqhlflfemslvfskevkdssgrskylyksklftselgvtehvegdp
ckfatsdnkivlkassienkqdwikhireviqert

Timeline for d2nz8b2:

• d2nz8b2 is new in SCOP 1.73
  
• d2nz8b2 appears in SCOP 1.75
  
• d2nz8b2 appears in the current release, SCOPe 2.08