SCOPe 2.08: Domain d2nz8b2: 2nz8 B:1415-1535

Lineage for d2nz8b2 (2nz8 B:1415-1535)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
   Pfam PF00169

6. Protein Triple functional domain protein TRIO [110264] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [110265] (3 PDB entries)
   Uniprot O75962 1231-1535

8. Domain d2nz8b2: 2nz8 B:1415-1535 [138839]
   Other proteins in same PDB: d2nz8a_, d2nz8b1

Details for d2nz8b2

PDB Entry: 2nz8, 2 Å

PDB Description: n-terminal dhph cassette of trio in complex with nucleotide-free rac1

PDB Compounds: (B:) triple functional domain protein

SCOPe Domain Sequences for d2nz8b2:

Sequence, based on SEQRES records:

>d2nz8b2 b.55.1.1 (B:1415-1535) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]}
egfdeniesqgelilqesfqvwdpktlirkgrerhlflfemslvfskevkdssgrskyly
ksklftselgvtehvegdpckfalwvgrtptsdnkivlkassienkqdwikhireviqer
t

Sequence, based on observed residues (ATOM records):

>d2nz8b2 b.55.1.1 (B:1415-1535) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]}
egfsqgelilqesfqhlflfemslvfskevkdssgrskylyksklftselgvtehvegdp
ckfatsdnkivlkassienkqdwikhireviqert

Timeline for d2nz8b2:

• d2nz8b2 first appeared in SCOP 1.73
  
• d2nz8b2 appears in SCOPe 2.07