Lineage for d2nz8b1 (2nz8 B:1231-1414)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004752Fold a.87: DBL homology domain (DH-domain) [48064] (1 superfamily)
    multihelical; core: 5-helical bundle
  4. 2004753Superfamily a.87.1: DBL homology domain (DH-domain) [48065] (2 families) (S)
    automatically mapped to Pfam PF00621
  5. 2004754Family a.87.1.1: DBL homology domain (DH-domain) [48066] (10 proteins)
    Pfam PF00621
  6. 2004815Protein Triple functional domain protein TRIO [109935] (1 species)
  7. 2004816Species Human (Homo sapiens) [TaxId:9606] [109936] (2 PDB entries)
    Uniprot O75962 1231-1535
  8. 2004818Domain d2nz8b1: 2nz8 B:1231-1414 [138838]
    Other proteins in same PDB: d2nz8a_, d2nz8b2
    automated match to d1ntya1

Details for d2nz8b1

PDB Entry: 2nz8 (more details), 2 Å

PDB Description: n-terminal dhph cassette of trio in complex with nucleotide-free rac1
PDB Compounds: (B:) triple functional domain protein

SCOPe Domain Sequences for d2nz8b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nz8b1 a.87.1.1 (B:1231-1414) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]}
arrkefimaeliqtekayvrdlrecmdtylwemtsgveeippgivnkeliifgnmqeiye
fhnniflkelekyeqlpedvghcfvtwadkfqmyvtycknkpdstqlilehagsyfdeiq
qrhglansissylikpvqritkyqlllkelltcceegkgeikdglevmlsvpkrandamh
lsml

SCOPe Domain Coordinates for d2nz8b1:

Click to download the PDB-style file with coordinates for d2nz8b1.
(The format of our PDB-style files is described here.)

Timeline for d2nz8b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2nz8b2
View in 3D
Domains from other chains:
(mouse over for more information)
d2nz8a_