![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (55 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families) ![]() |
![]() | Family d.58.7.1: Canonical RBD [54929] (67 proteins) |
![]() | Protein Splicesomal U1A protein [54932] (1 species) duplication: contains two domains of this fold |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54933] (28 PDB entries) |
![]() | Domain d2nz4d1: 2nz4 D:7-96 [138836] automatically matched to d1auda_ complexed with a2m, glp, gtp, mg; mutant |
PDB Entry: 2nz4 (more details), 2.5 Å
SCOP Domain Sequences for d2nz4d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nz4d1 d.58.7.1 (D:7-96) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} rpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssat nalrsmqgfpfydkpmriqyaktdsdiiak
Timeline for d2nz4d1: