SCOP 1.73: Domain d2nz4c1: 2nz4 C:8-96

Lineage for d2nz4c1 (2nz4 C:8-96)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families)

5. Family d.58.7.1: Canonical RBD [54929] (67 proteins)

6. Protein Splicesomal U1A protein [54932] (1 species)
   duplication: contains two domains of this fold

7. Species Human (Homo sapiens) [TaxId:9606] [54933] (28 PDB entries)

8. Domain d2nz4c1: 2nz4 C:8-96 [138835]
   automatically matched to d1auda_
   complexed with a2m, glp, gtp, mg; mutant

Details for d2nz4c1

PDB Entry: 2nz4, 2.5 Å

PDB Description: structural investigation of the glms ribozyme bound to its catalytic cofactor

PDB Compounds: (C:) U1 small nuclear ribonucleoprotein A

SCOP Domain Sequences for d2nz4c1:

Sequence; same for both SEQRES and ATOM records:

>d2nz4c1 d.58.7.1 (C:8-96) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]}
pnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssatn
alrsmqgfpfydkpmriqyaktdsdiiak

Timeline for d2nz4c1:

• d2nz4c1 is new in SCOP 1.73
  
• d2nz4c1 appears in SCOP 1.75
  
• d2nz4c1 appears in the current release, SCOPe 2.08, called d2nz4c_