Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.58: Ferredoxin-like [54861] (55 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families) |
Family d.58.7.1: Canonical RBD [54929] (67 proteins) |
Protein Splicesomal U1A protein [54932] (1 species) duplication: contains two domains of this fold |
Species Human (Homo sapiens) [TaxId:9606] [54933] (28 PDB entries) |
Domain d2nz4b1: 2nz4 B:7-96 [138834] automatically matched to d1auda_ complexed with a2m, glp, gtp, mg; mutant |
PDB Entry: 2nz4 (more details), 2.5 Å
SCOP Domain Sequences for d2nz4b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nz4b1 d.58.7.1 (B:7-96) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} rpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssat nalrsmqgfpfydkpmriqyaktdsdiiak
Timeline for d2nz4b1: