Lineage for d2nz4b1 (2nz4 B:7-96)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 724300Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families) (S)
  5. 724301Family d.58.7.1: Canonical RBD [54929] (67 proteins)
  6. 724585Protein Splicesomal U1A protein [54932] (1 species)
    duplication: contains two domains of this fold
  7. 724586Species Human (Homo sapiens) [TaxId:9606] [54933] (28 PDB entries)
  8. 724604Domain d2nz4b1: 2nz4 B:7-96 [138834]
    automatically matched to d1auda_
    complexed with a2m, glp, gtp, mg; mutant

Details for d2nz4b1

PDB Entry: 2nz4 (more details), 2.5 Å

PDB Description: structural investigation of the glms ribozyme bound to its catalytic cofactor
PDB Compounds: (B:) U1 small nuclear ribonucleoprotein A

SCOP Domain Sequences for d2nz4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nz4b1 d.58.7.1 (B:7-96) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]}
rpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssat
nalrsmqgfpfydkpmriqyaktdsdiiak

SCOP Domain Coordinates for d2nz4b1:

Click to download the PDB-style file with coordinates for d2nz4b1.
(The format of our PDB-style files is described here.)

Timeline for d2nz4b1: