SCOPe 2.01: Domain d2nyyd1: 2nyy D:2-118

Lineage for d2nyyd1 (2nyy D:2-118)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Engineered (including hybrid species) [88562] (67 PDB entries)
   SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # humanized antibody ! SQ NA # Humanized antibody ! SQ NA # engineered antibody

8. Domain d2nyyd1: 2nyy D:2-118 [138831]
   Other proteins in same PDB: d2nyyc1, d2nyyc2, d2nyyd2
   automatically matched to d1mhph1
   complexed with ca, zn

Details for d2nyyd1

PDB Entry: 2nyy, 2.61 Å

PDB Description: crystal structure of botulinum neurotoxin type a complexed with monoclonal antibody cr1

PDB Compounds: (D:) CR1 monoclonal antibody

SCOPe Domain Sequences for d2nyyd1:

Sequence; same for both SEQRES and ATOM records:

>d2nyyd1 b.1.1.1 (D:2-118) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)}
vqlqesggglvqpggslrlscaasgftfkydymywvrqapgkglewvatisdggsytyys
dsvegrfttsrdnskntlylqmnslraedtaiyycsryryddamdywgqgtlvtvss

Timeline for d2nyyd1:

• d2nyyd1 first appeared in SCOP 1.73
  
• d2nyyd1 appears in SCOP 1.75
  
• d2nyyd1 appears in SCOPe 2.02
  
• d2nyyd1 appears in the current release, SCOPe 2.08