| Class b: All beta proteins [48724] (176 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein automated matches [190374] (9 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries) |
| Domain d2nyyc2: 2nyy C:112-216 [138830] Other proteins in same PDB: d2nyya1, d2nyya2, d2nyya3, d2nyya4, d2nyyc1, d2nyyd1, d2nyyd2 automated match to d1n0xl2 complexed with ca, zn |
PDB Entry: 2nyy (more details), 2.61 Å
SCOPe Domain Sequences for d2nyyc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nyyc2 b.1.1.2 (C:112-216) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg
Timeline for d2nyyc2: