Lineage for d2nyyc2 (2nyy C:112-216)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1517226Protein automated matches [190374] (9 species)
    not a true protein
  7. 1517240Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries)
  8. 1517653Domain d2nyyc2: 2nyy C:112-216 [138830]
    Other proteins in same PDB: d2nyya1, d2nyya2, d2nyya3, d2nyya4, d2nyyc1, d2nyyd1, d2nyyd2
    automated match to d1n0xl2
    complexed with ca, zn

Details for d2nyyc2

PDB Entry: 2nyy (more details), 2.61 Å

PDB Description: crystal structure of botulinum neurotoxin type a complexed with monoclonal antibody cr1
PDB Compounds: (C:) CR1 monoclonal antibody

SCOPe Domain Sequences for d2nyyc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nyyc2 b.1.1.2 (C:112-216) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

SCOPe Domain Coordinates for d2nyyc2:

Click to download the PDB-style file with coordinates for d2nyyc2.
(The format of our PDB-style files is described here.)

Timeline for d2nyyc2: