Lineage for d2nyyc2 (2nyy C:115-215)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1293251Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)
  7. 1293252Species Human (Homo sapiens) [TaxId:9606] [88569] (147 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody
  8. 1293384Domain d2nyyc2: 2nyy C:115-215 [138830]
    Other proteins in same PDB: d2nyyc1, d2nyyd1, d2nyyd2
    automatically matched to d1egjl2
    complexed with ca, zn

Details for d2nyyc2

PDB Entry: 2nyy (more details), 2.61 Å

PDB Description: crystal structure of botulinum neurotoxin type a complexed with monoclonal antibody cr1
PDB Compounds: (C:) CR1 monoclonal antibody

SCOPe Domain Sequences for d2nyyc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nyyc2 b.1.1.2 (C:115-215) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
aapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskd
styslsstltlskadyekhkvyacevthqglsspvtksfnr

SCOPe Domain Coordinates for d2nyyc2:

Click to download the PDB-style file with coordinates for d2nyyc2.
(The format of our PDB-style files is described here.)

Timeline for d2nyyc2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2nyyc1