Lineage for d2nyrb1 (2nyr B:36-302)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 694236Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 694237Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (6 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 694413Family c.31.1.5: Sir2 family of transcriptional regulators [63984] (7 proteins)
    silent information regulator 2; contains insertion of a rubredoxin-like zinc finger domain
  6. 694459Protein NAD-dependent deacetylase sirtuin-5 [142128] (1 species)
  7. 694460Species Human (Homo sapiens) [TaxId:9606] [142129] (2 PDB entries)
  8. 694462Domain d2nyrb1: 2nyr B:36-302 [138828]
    automatically matched to 2B4Y A:36-302
    complexed with svr, zn

Details for d2nyrb1

PDB Entry: 2nyr (more details), 2.06 Å

PDB Description: Crystal Structure of Human Sirtuin Homolog 5 in Complex with Suramin
PDB Compounds: (B:) NAD-dependent deacetylase sirtuin-5

SCOP Domain Sequences for d2nyrb1:

Sequence, based on SEQRES records: (download)

>d2nyrb1 c.31.1.5 (B:36-302) NAD-dependent deacetylase sirtuin-5 {Human (Homo sapiens) [TaxId: 9606]}
psssmadfrkffakakhiviisgagvsaesgvptfrgaggywrkwqaqdlatplafahnp
srvwefyhyrrevmgskepnaghraiaecetrlgkqgrrvvvitqnidelhrkagtknll
eihgslfktrctscgvvaenykspicpalsgkgapepgtqdasipveklprceeagcggl
lrphvvwfgenldpaileevdrelahcdlclvvgtssvvypaamfapqvaargvpvaefn
tettpatnrfrfhfqgpcgttlpeala

Sequence, based on observed residues (ATOM records): (download)

>d2nyrb1 c.31.1.5 (B:36-302) NAD-dependent deacetylase sirtuin-5 {Human (Homo sapiens) [TaxId: 9606]}
psssmadfrkffakakhiviisgagvsaesgvptfrgaggywrkwqaqdlatplafahnp
srvwefyhyrrevmgskepnaghraiaecetrlgkqgrrvvvitqnidelhrkagtknll
eihgslfktrctscgvvaenykspicpalsgkgapepgtqdasipveklprceeagcggl
lrphvvwfgenldpaileevdrelahcdlclvvgtssvvypaamfapqvaargvpvaefn
trfhfqgpcgttlpeala

SCOP Domain Coordinates for d2nyrb1:

Click to download the PDB-style file with coordinates for d2nyrb1.
(The format of our PDB-style files is described here.)

Timeline for d2nyrb1: