Lineage for d2nymd1 (2nym D:9-589)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 775276Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 775277Superfamily a.118.1: ARM repeat [48371] (23 families) (S)
  5. 775365Family a.118.1.2: HEAT repeat [48385] (2 proteins)
    Pfam PF02985
    this is a repeat family; one repeat unit is 1b3u A:295-335 found in domain
  6. 775366Protein Constant regulatory domain of protein phosphatase 2a, pr65alpha [48386] (1 species)
  7. 775367Species Human (Homo sapiens) [TaxId:9606] [48387] (8 PDB entries)
  8. 775379Domain d2nymd1: 2nym D:9-589 [138824]
    Other proteins in same PDB: d2nymb1, d2nymc1, d2nyme1, d2nymf1
    automatically matched to d1b3ua_
    complexed with acb, add, cab, mn

Details for d2nymd1

PDB Entry: 2nym (more details), 3.6 Å

PDB Description: crystal structure of protein phosphatase 2a (pp2a) with c-terminus truncated catalytic subunit
PDB Compounds: (D:) Protein phosphatase 2

SCOP Domain Sequences for d2nymd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nymd1 a.118.1.2 (D:9-589) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]}
slypiavlidelrnedvqlrlnsikklstialalgvertrsellpfltdtiydedevlla
laeqlgtfttlvggpeyvhcllppleslatveetvvrdkaveslraishehspsdleahf
vplvkrlaggdwftsrtsacglfsvcyprvssavkaelrqyfrnlcsddtpmvrraaask
lgefakvleldnvkseiipmfsnlasdeqdsvrllaveacvniaqllpqedlealvmptl
rqaaedkswrvrymvadkftelqkavgpeitktdlvpafqnlmkdceaevraaashkvke
fcenlsadcrenvimsqilpcikelvsdanqhvksalasvimglspilgkdntiehllpl
flaqlkdecpevrlniisnldcvnevigirqlsqsllpaivelaedakwrvrlaiieymp
llagqlgveffdeklnslcmawlvdhvyaireaatsnlkklvekfgkewahatiipkvla
msgdpnylhrmttlfcinvlsevcgqdittkhmlptvlrmagdpvanvrfnvakslqkig
pildnstlqsevkpilekltqdqdvdvkyfaqealtvlsla

SCOP Domain Coordinates for d2nymd1:

Click to download the PDB-style file with coordinates for d2nymd1.
(The format of our PDB-style files is described here.)

Timeline for d2nymd1: