Lineage for d2nyhb_ (2nyh B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2198638Superfamily d.58.55: DOPA-like [143410] (2 families) (S)
    probable biological unit is homodimer; the extra C-terminal strand, adjacent and antiparallel to strand 4, contributes to the dimerisation interface
  5. 2198639Family d.58.55.1: DOPA dioxygenase-like [143411] (1 protein)
    Pfam PF08883
  6. 2198640Protein Putative dioxygenase BxeB0224 [143412] (1 species)
    Bxeno_B2751
  7. 2198641Species Burkholderia xenovorans [TaxId:36873] [143413] (2 PDB entries)
    Uniprot Q13JM0 1-115
  8. 2198647Domain d2nyhb_: 2nyh B: [138814]
    Other proteins in same PDB: d2nyha2
    automated match to d2nyha1
    complexed with so4

Details for d2nyhb_

PDB Entry: 2nyh (more details), 1.7 Å

PDB Description: crystal structure of putative dioxygenase (yp_555069.1) from burkholderia xenovorans lb400 at 1.70 a resolution
PDB Compounds: (B:) Putative dioxygenase

SCOPe Domain Sequences for d2nyhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nyhb_ d.58.55.1 (B:) Putative dioxygenase BxeB0224 {Burkholderia xenovorans [TaxId: 36873]}
mtfrdtsaiaswhahvyfdassrdaawtlreqieahwsgklqlgrfherpvgphpmwsyq
laftqeqfadlvgwltlnhgaldiflhpntgdalrdhrdaavwighshelvlsal

SCOPe Domain Coordinates for d2nyhb_:

Click to download the PDB-style file with coordinates for d2nyhb_.
(The format of our PDB-style files is described here.)

Timeline for d2nyhb_: