SCOP 1.75: Domain d2nyhb1: 2nyh B:1-115

Lineage for d2nyhb1 (2nyh B:1-115)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.55: DOPA-like [143410] (1 family)
   probable biological unit is homodimer; the extra C-terminal strand, adjacent and antiparallel to strand 4, contributes to the dimerisation interface

5. Family d.58.55.1: DOPA dioxygenase-like [143411] (1 protein)
   Pfam PF08883

6. Protein Putative dioxygenase BxeB0224 [143412] (1 species)
   Bxeno_B2751

7. Species Burkholderia xenovorans [TaxId:36873] [143413] (2 PDB entries)
   Uniprot Q13JM0 1-115

8. Domain d2nyhb1: 2nyh B:1-115 [138814]
   automatically matched to 2NYH A:1-115
   complexed with so4

Details for d2nyhb1

PDB Entry: 2nyh, 1.7 Å

PDB Description: crystal structure of putative dioxygenase (yp_555069.1) from burkholderia xenovorans lb400 at 1.70 a resolution

PDB Compounds: (B:) Putative dioxygenase

SCOP Domain Sequences for d2nyhb1:

Sequence; same for both SEQRES and ATOM records:

>d2nyhb1 d.58.55.1 (B:1-115) Putative dioxygenase BxeB0224 {Burkholderia xenovorans [TaxId: 36873]}
mtfrdtsaiaswhahvyfdassrdaawtlreqieahwsgklqlgrfherpvgphpmwsyq
laftqeqfadlvgwltlnhgaldiflhpntgdalrdhrdaavwighshelvlsal

Timeline for d2nyhb1:

• d2nyhb1 first appeared in SCOP 1.73
  
• d2nyhb1 is called d2nyhb_ in SCOPe 2.01
  
• d2nyhb1 appears in the current release, SCOPe 2.08, called d2nyhb_