Lineage for d2nyhb1 (2nyh B:1-115)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 726152Superfamily d.58.55: DOPA-like [143410] (1 family) (S)
    probable biological unit is homodimer; the extra C-terminal strand, adjacent and antiparallel to strand 4, contributes to the dimerisation interface
  5. 726153Family d.58.55.1: DOPA dioxygenase-like [143411] (1 protein)
    Pfam PF08883
  6. 726154Protein Putative dioxygenase BxeB0224 [143412] (1 species)
    Bxeno_B2751
  7. 726155Species Burkholderia xenovorans [TaxId:36873] [143413] (2 PDB entries)
  8. 726161Domain d2nyhb1: 2nyh B:1-115 [138814]
    automatically matched to 2NYH A:1-115
    complexed with so4

Details for d2nyhb1

PDB Entry: 2nyh (more details), 1.7 Å

PDB Description: crystal structure of putative dioxygenase (yp_555069.1) from burkholderia xenovorans lb400 at 1.70 a resolution
PDB Compounds: (B:) Putative dioxygenase

SCOP Domain Sequences for d2nyhb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nyhb1 d.58.55.1 (B:1-115) Putative dioxygenase BxeB0224 {Burkholderia xenovorans [TaxId: 36873]}
mtfrdtsaiaswhahvyfdassrdaawtlreqieahwsgklqlgrfherpvgphpmwsyq
laftqeqfadlvgwltlnhgaldiflhpntgdalrdhrdaavwighshelvlsal

SCOP Domain Coordinates for d2nyhb1:

Click to download the PDB-style file with coordinates for d2nyhb1.
(The format of our PDB-style files is described here.)

Timeline for d2nyhb1: