Lineage for d2ny7l1 (2ny7 L:1-107)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 782637Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 782778Species Human (Homo sapiens), cluster 3.1 [TaxId:9606] [88522] (8 PDB entries)
  8. 782784Domain d2ny7l1: 2ny7 L:1-107 [138802]
    Other proteins in same PDB: d2ny7g1, d2ny7h1, d2ny7h2, d2ny7l2
    automatically matched to d1hzhl1
    complexed with nag; mutant

Details for d2ny7l1

PDB Entry: 2ny7 (more details), 2.3 Å

PDB Description: hiv-1 gp120 envelope glycoprotein complexed with the broadly neutralizing cd4-binding-site antibody b12
PDB Compounds: (L:) ANTIBODY b12, LIGHT CHAIN

SCOP Domain Sequences for d2ny7l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ny7l1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.1 [TaxId: 9606]}
eivltqspgtlslspgeratfscrsshsirsrrvawyqhkpgqaprlvihgvsnrasgis
drfsgsgsgtdftltitrvepedfalyycqvygassytfgqgtklerk

SCOP Domain Coordinates for d2ny7l1:

Click to download the PDB-style file with coordinates for d2ny7l1.
(The format of our PDB-style files is described here.)

Timeline for d2ny7l1: