Lineage for d2ny7h2 (2ny7 H:114-230)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655111Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 655115Species Human (Homo sapiens) [TaxId:9606] [88575] (150 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 655192Domain d2ny7h2: 2ny7 H:114-230 [138801]
    Other proteins in same PDB: d2ny7h1, d2ny7l1, d2ny7l2
    automatically matched to d1ngzb2
    complexed with nag; mutant

Details for d2ny7h2

PDB Entry: 2ny7 (more details), 2.3 Å

PDB Description: hiv-1 gp120 envelope glycoprotein complexed with the broadly neutralizing cd4-binding-site antibody b12
PDB Compounds: (H:) ANTIBODY b12, HEAVY CHAIN

SCOP Domain Sequences for d2ny7h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ny7h2 b.1.1.2 (H:114-230) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkaepksc

SCOP Domain Coordinates for d2ny7h2:

Click to download the PDB-style file with coordinates for d2ny7h2.
(The format of our PDB-style files is described here.)

Timeline for d2ny7h2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ny7h1