Lineage for d2ny7h1 (2ny7 H:1-113)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2021582Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2021692Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88544] (37 PDB entries)
  8. 2021720Domain d2ny7h1: 2ny7 H:1-113 [138800]
    Other proteins in same PDB: d2ny7g_, d2ny7h2, d2ny7l1, d2ny7l2
    automatically matched to d1hzhh1
    complexed with nag

Details for d2ny7h1

PDB Entry: 2ny7 (more details), 2.3 Å

PDB Description: hiv-1 gp120 envelope glycoprotein complexed with the broadly neutralizing cd4-binding-site antibody b12
PDB Compounds: (H:) ANTIBODY b12, HEAVY CHAIN

SCOPe Domain Sequences for d2ny7h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ny7h1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]}
qvqlvqsgaevkkpgasvkvscqasgyrfsnfvihwvrqapgqrfewmgwinpyngnkef
sakfqdrvtftadtsantaymelrslrsadtavyycarvgpyswddspqdnyymdvwgkg
ttvivss

SCOPe Domain Coordinates for d2ny7h1:

Click to download the PDB-style file with coordinates for d2ny7h1.
(The format of our PDB-style files is described here.)

Timeline for d2ny7h1: