SCOPe 2.08: Domain d2ny6d1: 2ny6 D:3001-3128

Lineage for d2ny6d1 (2ny6 D:3001-3128)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88544] (37 PDB entries)

8. Domain d2ny6d1: 2ny6 D:3001-3128 [138798]
   Other proteins in same PDB: d2ny6a1, d2ny6b1, d2ny6b2, d2ny6c1, d2ny6c2, d2ny6d2
   automated match to d1rzjh1
   complexed with nag

Details for d2ny6d1

PDB Entry: 2ny6, 2.8 Å

PDB Description: hiv-1 gp120 envelope glycoprotein (m95w, w96c, i109c, t123c, t257s, v275c,s334a, s375w, q428c, g431c) complexed with cd4 and antibody 17b

PDB Compounds: (D:) antibody 17b, heavy chain

SCOPe Domain Sequences for d2ny6d1:

Sequence; same for both SEQRES and ATOM records:

>d2ny6d1 b.1.1.1 (D:3001-3128) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]}
evqlvesgaevkkpgssvkvsckasgdtfirysftwvrqapgqglewmgriitildvahy
aphlqgrvtitadkststvylelrnlrsddtavyfcagvyegeadegeydnngflkhwgq
gtlvtvss

Timeline for d2ny6d1:

• d2ny6d1 first appeared in SCOP 1.73
  
• d2ny6d1 appears in SCOPe 2.07