SCOPe 2.07: Domain d2ny6b2: 2ny6 B:1098-1181

Lineage for d2ny6b2 (2ny6 B:1098-1181)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.3: C2 set domains [49142] (8 proteins)

6. Protein CD4 C2-set domains [49149] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49150] (32 PDB entries)

8. Domain d2ny6b2: 2ny6 B:1098-1181 [138795]
   Other proteins in same PDB: d2ny6a1, d2ny6b1, d2ny6c1, d2ny6c2, d2ny6d1, d2ny6d2
   complexed with nag, suc

Details for d2ny6b2

PDB Entry: 2ny6, 2.8 Å

PDB Description: hiv-1 gp120 envelope glycoprotein (m95w, w96c, i109c, t123c, t257s, v275c,s334a, s375w, q428c, g431c) complexed with cd4 and antibody 17b

PDB Compounds: (B:) T-cell surface glycoprotein cd4

SCOPe Domain Sequences for d2ny6b2:

Sequence; same for both SEQRES and ATOM records:

>d2ny6b2 b.1.1.3 (B:1098-1181) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]}
fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw
tctvlqnqkkvefkidivvlafqk

Timeline for d2ny6b2:

• d2ny6b2 first appeared in SCOP 1.73
  
• d2ny6b2 appears in SCOPe 2.06
  
• d2ny6b2 appears in the current release, SCOPe 2.08