Lineage for d2ny6b1 (2ny6 B:1001-1097)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1755540Protein CD4 V-set domains [48737] (2 species)
  7. 1755541Species Human (Homo sapiens) [TaxId:9606] [48738] (31 PDB entries)
  8. 1755561Domain d2ny6b1: 2ny6 B:1001-1097 [138794]
    Other proteins in same PDB: d2ny6a1, d2ny6b2, d2ny6c1, d2ny6c2, d2ny6d1, d2ny6d2
    complexed with nag, suc

Details for d2ny6b1

PDB Entry: 2ny6 (more details), 2.8 Å

PDB Description: hiv-1 gp120 envelope glycoprotein (m95w, w96c, i109c, t123c, t257s, v275c,s334a, s375w, q428c, g431c) complexed with cd4 and antibody 17b
PDB Compounds: (B:) T-cell surface glycoprotein cd4

SCOPe Domain Sequences for d2ny6b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ny6b1 b.1.1.1 (B:1001-1097) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]}
kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrrs
lwdqgnfpliiknlkiedsdtyicevedqkeevqllv

SCOPe Domain Coordinates for d2ny6b1:

Click to download the PDB-style file with coordinates for d2ny6b1.
(The format of our PDB-style files is described here.)

Timeline for d2ny6b1: